Protein Info for PS417_02710 in Pseudomonas simiae WCS417
Updated annotation (from data): Urease maturation and nickel insertion protein UreE
Rationale: Specific phenotype: utilization of Inosine, Urea. (Inosine is broken down to ureidoglycolate, which is cleaved to glyoxylate and urea by PS417_19430.) For the specific role of UreE, see PMID:23539618
Original annotation: urease accessory protein UreE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to UREE_PSEFS: Urease accessory protein UreE (ureE) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K03187, urease accessory protein (inferred from 98% identity to pfs:PFLU0563)Predicted SEED Role
"Urease accessory protein UreE" in subsystem Urea decomposition
MetaCyc Pathways
- urea degradation II (1/1 steps found)
- superpathway of allantoin degradation in plants (4/8 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U680 at UniProt or InterPro
Protein Sequence (166 amino acids)
>PS417_02710 Urease maturation and nickel insertion protein UreE (Pseudomonas simiae WCS417) MLVIHRRIAPQALWAAELLLNFEARSKSRLRCFSADGEDVGLFLERGQPPLHDGEFLQAE DGRVVRVCARPEHLLHVTCSSAFELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQ LGAQTATIEAPFQPEHGAYGGGHHHSRHGDEDFNYPPKLHQFGVRL