Protein Info for PS417_02710 in Pseudomonas simiae WCS417

Updated annotation (from data): Urease maturation and nickel insertion protein UreE
Rationale: Specific phenotype: utilization of Inosine, Urea. (Inosine is broken down to ureidoglycolate, which is cleaved to glyoxylate and urea by PS417_19430.) For the specific role of UreE, see PMID:23539618
Original annotation: urease accessory protein UreE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF02814: UreE_N" amino acids 7 to 65 (59 residues), 65.2 bits, see alignment E=2.9e-22 PF05194: UreE_C" amino acids 72 to 149 (78 residues), 98.9 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 98% identical to UREE_PSEFS: Urease accessory protein UreE (ureE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03187, urease accessory protein (inferred from 98% identity to pfs:PFLU0563)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U680 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PS417_02710 Urease maturation and nickel insertion protein UreE (Pseudomonas simiae WCS417)
MLVIHRRIAPQALWAAELLLNFEARSKSRLRCFSADGEDVGLFLERGQPPLHDGEFLQAE
DGRVVRVCARPEHLLHVTCSSAFELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQ
LGAQTATIEAPFQPEHGAYGGGHHHSRHGDEDFNYPPKLHQFGVRL