Protein Info for GFF532 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Na+ driven multidrug efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 19 to 420 (402 residues), 236.3 bits, see alignment E=2.9e-74 PF01554: MatE" amino acids 19 to 178 (160 residues), 104.8 bits, see alignment E=2e-34 amino acids 248 to 409 (162 residues), 103.8 bits, see alignment E=4.1e-34

Best Hits

Swiss-Prot: 42% identical to YOEA_BACSU: Probable multidrug resistance protein YoeA (yoeA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 75% identity to pfs:PFLU2538)

Predicted SEED Role

"Na+ driven multidrug efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>GFF532 Na+ driven multidrug efflux pump (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPNAPQGPLWRVYLVFLVPMVLSNILQGLSGTLNGIFIGQMLGTHALAAVSGMFPIVFFF
ISLVIGIGAGASVLIGQAWGAREPHKVKAIAGTALVLGALIGLVAAVLGVVFARPALQAL
GTPVDVLDDAVAYARVMLLIMPLLLVFILFTQLLRGVSDTVSPLIALLLSTALGLLLTPA
LIQGWLGLPRLGIQSAAYAGLVSYAAALGFLAWRLGRKHHVLAVDRELIGALRLDRDILA
KVMRIGIPTGLQMVVISVSELVILALVNGHGSQATAAYGAVTQVVNYVQFPALSIAITAS
ILAAQSIGAGRVDRLGAILRTGLWLNAVLTGALVLLGYALSHKLMGLFLTQPEVRAQAEH
LLHIMLWSILVFGFQAVVGGLMRASGVVMVPMAISVFCILAIQLPAAYVLDAKMGLPGVW
VAFPVAYVAMLVMQTAYYRLVWRHRKIERLV