Protein Info for GFF5319 in Variovorax sp. SCN45

Annotation: Type IV pilus biogenesis protein PilM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR01175: type IV pilus assembly protein PilM" amino acids 15 to 357 (343 residues), 287.3 bits, see alignment E=7.6e-90 PF11104: PilM_2" amino acids 17 to 357 (341 residues), 488.2 bits, see alignment E=5.9e-151

Best Hits

KEGG orthology group: K02662, type IV pilus assembly protein PilM (inferred from 97% identity to vpe:Varpa_1226)

Predicted SEED Role

"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>GFF5319 Type IV pilus biogenesis protein PilM (Variovorax sp. SCN45)
LASLGSLFRRQNAPLLGLDVSSSSVKLVELGREASGKLVLERCAIEPLERGWITDGNVEK
FDEVAEAVRRVIRKSGTRTRNVALALPPSAVITKKIILPGGMSEQELEIQVESEANQYIP
FSLDEVSLDFCVTGPSMTSAGDVEVLIAASRKEKVQDREGLAEAAGLKAMILDVESYASR
LATARLIEQLPGKGVDAVVALFEVGAFTTSMQVLRNQEVLYDRDQAFGGAQLTQLIVRQY
GFSAEEAEAKKRSGDLPDDYGSGVLKPFVESIAQEIARALQFFFTSTPHNRVDYVLLAGG
SSSLPGLTNAVTRQTSFACSLVNPFDGMDFGPNIREKKVRREAPSYLTSCGLAMRRFLQ