Protein Info for GFF5310 in Variovorax sp. SCN45

Annotation: Cytochrome c4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00034: Cytochrom_C" amino acids 43 to 123 (81 residues), 36.8 bits, see alignment E=8.2e-13 amino acids 155 to 225 (71 residues), 37.8 bits, see alignment E=3.9e-13 PF13442: Cytochrome_CBB3" amino acids 57 to 121 (65 residues), 26.3 bits, see alignment E=7.6e-10 amino acids 155 to 222 (68 residues), 24 bits, see alignment E=3.9e-09

Best Hits

Swiss-Prot: 45% identical to CYC4_PSEST: Cytochrome c4 (cc4) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 82% identity to vpe:Varpa_1217)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF5310 Cytochrome c4 (Variovorax sp. SCN45)
MKLFANIVLAALVGLASSVSFAADEHAAAPAAAPAKPAKPDPAKGDTLFSASTPTVQSCA
SCHNADGNSTIAANPKLAQQHPEYILKQLQDFKSGKRKNSVMSPMAANLSDQDMRDIAWF
VASKKIKTGFSKDKDTVALGEKIYRGGIGERSIPACAGCHSPNGAGLPAQYPRLGGQNAD
YTVAQLKAFRGDGTPVRTNSGPMTGVAAKLNDREIAAVADYIAGLR