Protein Info for GFF5310 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Replicative DNA helicase (EC 3.6.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00772: DnaB" amino acids 21 to 122 (102 residues), 113.6 bits, see alignment E=8.7e-37 TIGR00665: replicative DNA helicase" amino acids 21 to 455 (435 residues), 406 bits, see alignment E=9.6e-126 PF03796: DnaB_C" amino acids 199 to 455 (257 residues), 256.1 bits, see alignment E=6.7e-80 PF06745: ATPase" amino acids 199 to 388 (190 residues), 38.7 bits, see alignment E=1.5e-13 PF13481: AAA_25" amino acids 203 to 374 (172 residues), 52.6 bits, see alignment E=9.6e-18

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 51% identity to rfr:Rfer_2580)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>GFF5310 Replicative DNA helicase (EC 3.6.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNMTEPEDFMADPEAATLRVPPHSIESETAVLGALLLNNAAWDRVADLLAEADFYRSEHR
VLFGAIAALINASKPADVVTVFERLRDQGKAEDAGGLGYLNGLAQYLPSAANVRRYAEIV
REKSVLRQLVAASDELAAAAFNPGDRTAAEVLDQAQQQIIALGDQGAPRDDWEGTEDGMV
ALLGRIEDQAQGTGGQTFVPTGLAELDELLNGGLREGHLIALGGRPSMGKTALAMSIGNT
FAEAGHAVGMLSMEMPRTEVHERRMSMVSQIHLSRVQRGERLRDFDWPRITEATERLRRT
PFYTSDQVGLNINQVRAKARALKRRHGLRLLIVDYLGLMAGTDSKMSRAYQLDEITKGLK
GLAKELGITVLMLAQIDRKVEQRTDQRPLMSDFRDSGSVEQDADVCIFVYRECRAKPGLP
TEWDYIAELIVAKQRGGAAGKVEVMYVGENTLFKDWPEDQPKPESRVRVKGGDL