Protein Info for PS417_27160 in Pseudomonas simiae WCS417

Annotation: alkanesulfonate transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 245 (168 residues), 107.6 bits, see alignment E=3.4e-35

Best Hits

Swiss-Prot: 76% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to pfs:PFLU5855)

MetaCyc: 76% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UML4 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PS417_27160 alkanesulfonate transporter permease subunit (Pseudomonas simiae WCS417)
MNYEKLSHRVAPWVLPVLLLVVWQLSVSAGWLSTRILPAPSAVIEAGINLVASGEIWTHL
AISGWRAGLGFLIGGSIGLALGFITGLSKWGERLLDSSVQMIRNVPHLALIPLVILWFGI
DETAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMSRSYGLSGFSLFRQVILPGALPSIL
VGVRFALGFMWLTLIVAETISASAGIGYLAMNAREFLQTDVVVLAIVMYAILGKLADLAA
RGLERVWLRWHPAYQVNKGGVA