Protein Info for PS417_02700 in Pseudomonas simiae WCS417

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00101: urease accessory protein UreG" amino acids 6 to 201 (196 residues), 331.6 bits, see alignment E=8.7e-104 PF02492: cobW" amino acids 8 to 178 (171 residues), 128.8 bits, see alignment E=9e-42

Best Hits

Swiss-Prot: 99% identical to UREG_PSEFS: Urease accessory protein UreG (ureG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03189, urease accessory protein (inferred from 99% identity to pfs:PFLU0561)

MetaCyc: 64% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UF72 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PS417_02700 urease accessory protein UreG (Pseudomonas simiae WCS417)
MNTQPLRVGIGGPVGSGKTALTLALCLALRDRYNLAVVTNDIYTREDADFLVRNQALAPE
RIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESGGDNLSATFSPELSDLT
IYVIDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLELMNSDTTRMRNGKPFVFS
NQKTGVGLEDIVAFIERQGLLTAA