Protein Info for PS417_00270 in Pseudomonas simiae WCS417

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00034: Cytochrom_C" amino acids 26 to 121 (96 residues), 23.5 bits, see alignment E=1.7e-08 amino acids 310 to 396 (87 residues), 51.2 bits, see alignment E=4e-17 PF13442: Cytochrome_CBB3" amino acids 310 to 393 (84 residues), 37.2 bits, see alignment E=4.5e-13

Best Hits

Swiss-Prot: 66% identical to GADH2_PANCY: Gluconate 2-dehydrogenase cytochrome c subunit from Pantoea cypripedii

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU0053)

MetaCyc: 84% identical to D-gluconate dehydrogenase cytochrome c subunit (Pseudomonas fluorescens)
Gluconate 2-dehydrogenase (acceptor). [EC: 1.1.99.3]

Predicted SEED Role

"Gluconate 2-dehydrogenase (EC 1.1.99.3), membrane-bound, cytochrome c" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.3

Use Curated BLAST to search for 1.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TU08 at UniProt or InterPro

Protein Sequence (420 amino acids)

>PS417_00270 alcohol dehydrogenase (Pseudomonas simiae WCS417)
MKALVIATFALFSSCSVSAAETDLIKQGEYLARAGDCVACHTAKGGKPFAGGLPMETPIG
VIYSTNITPDKTGLGDYSFEDFDKAVRHGVAKSGSTLYPAMPYPSYARVSDSDMQALYAY
FMKGVEPVAQENKDSDIPWPLSMRWPLAAWRWMFAPAVEEHQAQAVVDPVISRGAYLVEG
LGHCGACHTPRALTMQEKALSATDGNAFLAGSAPLEGWIAKSLRGDHKDGLGSWSEEQLV
QFLKTGRSDRSAVFGGMSDVVVHSMQYMSENDLTAIARYLKSLPAVDPKDSPHTYDKQVA
EALWKGDDSQRGASVYIDNCAACHRTDGHGYTRVFPALAGNPVLQTADATSLINIVLNGG
TLPATHTAPSTFTMPAFAWRLSDQEVADVVSFVRGSWGNTGGAISAAQVADIRKKSGDKN