Protein Info for GFF5291 in Variovorax sp. SCN45

Annotation: Ferrichrome-iron receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07715: Plug" amino acids 67 to 162 (96 residues), 81.9 bits, see alignment E=7e-27 TIGR01783: TonB-dependent siderophore receptor" amino acids 69 to 716 (648 residues), 360.7 bits, see alignment E=8.6e-112 PF00593: TonB_dep_Rec" amino acids 234 to 685 (452 residues), 216.8 bits, see alignment E=1.6e-67 PF14905: OMP_b-brl_3" amino acids 397 to 699 (303 residues), 45 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 74% identity to ajs:Ajs_1523)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (716 amino acids)

>GFF5291 Ferrichrome-iron receptor (Variovorax sp. SCN45)
MNKNSSPCVQAVQLLAAGATMAIGINAAWAQTAAAGNPLPTVTVTGDTEPGYAAKRSSTA
TKTDTLLRDTPQSISVITGDDMRDRAVQSLAEAARYVPGVNFAQGEGNRETPIFRGISTT
GDFFIDGIRDDVQYYRDLYNIERVEVFKGPNAMIFGRGATGGLINRVSKMPEWTPFYGGS
VTLGSYDNRRLTVDLNQPINDQLAFRLNGMYENSRSYRDGVWLERSGVNPTISWRPNAKT
LVTLGYEHFKDDRIADRGITSFRGVPVVTSPSTFFGNAAGSPTGSTLDAFNALVEHEFDN
GVLLRNRTRWSNQDKFYQNVFPGAVNAAGTGVAISAYNNATSRKSVFNQTDLTFSLNTGG
IRHKLLVGAELGQQDTDNFRNTGYFNNTATSVTVPLAFPTTNLPVVYRQAATDANNSGKA
NVAALYVQDQVELSPQFQVIAGLRYDQFKVDFRNNRNGDRFKTSDDLLSPRLGVIYKPVE
QVSLYANYSIAYQPRAGDQLASLTLSNAALEPEKFKNYEIGAKWDVSHSLAATAALYRLD
RSNVVVLDPSDPTGTRTILSKGQRTQGFELGLNGNITPAWSVAGGYSYTDAKFVADTSST
IRAGARVGMVPKHTLALWNRYDFSPMWGAGLGVIRQSKMYASSEQVVTSAAPFPNVVLPG
YTRVDAAVFFTLNKNLQMQLNVENLFNKRYFLNANSNTNITPGSPRAFRVSLNAKF