Protein Info for PS417_02695 in Pseudomonas simiae WCS417

Annotation: protein hupE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details PF04955: HupE_UreJ" amino acids 11 to 187 (177 residues), 204.8 bits, see alignment E=7.8e-65 PF13795: HupE_UreJ_2" amino acids 32 to 134 (103 residues), 24.7 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 44% identical to HUPE_RHILV: Protein HupE (hupE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03192, urease accessory protein (inferred from 99% identity to pfs:PFLU0560)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9F0 at UniProt or InterPro

Protein Sequence (190 amino acids)

>PS417_02695 protein hupE (Pseudomonas simiae WCS417)
MSLKKLFTAAALLLAPALAFAHPGHGDNGLVAGISHPLSGIDHLLAMVAVGLWAAQQKGA
ARWALPCTFVGTMLIGGVLGFEGLALPALESGIAASVLALGLAVALAVRPPLFMAVGATA
LFALFHGVAHGLELPDMSSPWAYAAGFVGATAVLHAAGYAVVRFLPAAAAPLVRIAGAAS
AATGVWLLAG