Protein Info for GFF529 in Variovorax sp. SCN45

Annotation: UDP-galactose-lipid carrier transferase (EC 2.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03709: polyphosphate:nucleotide phosphotransferase, PPK2 family
  • amino acids 8 to 262 (255 residues), 347.1 bits, E=2.9e-108
• PF03976: PPK2
  • amino acids 30 to 253 (224 residues), 238.7 bits, E=3.1e-75

Best Hits

Swiss-Prot: 48% identical to PK23_MEIRD: Polyphosphate:AMP/ADP phosphotransferase (K649_10090) from Meiothermus ruber (strain ATCC 35948 / DSM 1279 / VKM B-1258 / 21)

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_3459)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Protein Sequence (268 amino acids)

>GFF529 UDP-galactose-lipid carrier transferase (EC 2.-.-.-) (Variovorax sp. SCN45)
MASFKKYRVGDKFKLSHIDPDDTPFCEGDEASQRAEVDALAVELDELQDLLHAEGRRKLL
LVLQGMDTSGKDGTVRWVFSRTSPLGVRVTAFKAPNDEERAHDYLWRCHAAVPRTGEIMV
WNRSHYEDVLVPVVEGWIDKAEAKRRYAQINDFERLLTETGTVVIKCMLHIDKDEQRERL
QARIDTPGKQWKFSMDDLRVRTKWNAYQQAYQSALAATSTEHAPWHVIPANSKRHRNVMV
AQLLVKTMRQMKLKPPPPDPALKGMIIK