Protein Info for GFF5277 in Variovorax sp. SCN45

Annotation: Sorbitol dehydrogenase (EC 1.1.1.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF23441: SDR" amino acids 4 to 259 (256 residues), 31.5 bits, see alignment E=3.2e-11 PF00106: adh_short" amino acids 9 to 199 (191 residues), 180.4 bits, see alignment E=7.3e-57 PF08659: KR" amino acids 10 to 164 (155 residues), 54.1 bits, see alignment E=4.7e-18 PF01370: Epimerase" amino acids 10 to 171 (162 residues), 21 bits, see alignment E=5.1e-08 PF13561: adh_short_C2" amino acids 14 to 258 (245 residues), 193.9 bits, see alignment E=8.4e-61

Best Hits

KEGG orthology group: K08261, D-sorbitol dehydrogenase (acceptor) [EC: 1.1.99.21] (inferred from 94% identity to vap:Vapar_1113)

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14 or 1.1.99.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF5277 Sorbitol dehydrogenase (EC 1.1.1.14) (Variovorax sp. SCN45)
MNGRLRDRHVLLTGAGGGIGLAVARACIAEGARCTVIDRAIAAPEAVRTLQQAHPDRLAY
IAADVTDTAAITHMLAEAQVAFGPVHTLFNNAAVFDLAPLLDSDEASFDRLFAVNVKGMF
FVMQAVLRHMVEAGTQGASVINMASQAGRRGEALVAHYCATKAAVISYTQSAALAMAPHG
IRVNGIAPGVVDTPMWDHVDSLFAKAEGLPPGEKKRQVGLAVPLGRMGVPDDIAGAAVFL
ASDEARYITAQTLNVDGGNVMS