Protein Info for GFF5272 in Pseudomonas sp. DMC3

Annotation: Biofilm dispersion protein BdlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF08448: PAS_4" amino acids 34 to 138 (105 residues), 45.8 bits, see alignment E=1.7e-15 amino acids 156 to 259 (104 residues), 33.4 bits, see alignment E=1.2e-11 TIGR00229: PAS domain S-box protein" amino acids 34 to 143 (110 residues), 68.9 bits, see alignment E=2.2e-23 amino acids 144 to 262 (119 residues), 42.1 bits, see alignment E=4.3e-15 PF13426: PAS_9" amino acids 36 to 137 (102 residues), 47.7 bits, see alignment E=4.2e-16 amino acids 159 to 258 (100 residues), 36.5 bits, see alignment E=1.2e-12 PF00989: PAS" amino acids 37 to 135 (99 residues), 33.6 bits, see alignment E=8.8e-12 PF08447: PAS_3" amino acids 46 to 132 (87 residues), 46.4 bits, see alignment E=1e-15 amino acids 168 to 253 (86 residues), 46.3 bits, see alignment E=1e-15 PF00015: MCPsignal" amino acids 277 to 434 (158 residues), 122.2 bits, see alignment E=5.5e-39

Best Hits

Swiss-Prot: 48% identical to BDLA_PSEAE: Biofilm dispersion protein BdlA (bdlA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 93% identity to pfo:Pfl01_4343)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>GFF5272 Biofilm dispersion protein BdlA (Pseudomonas sp. DMC3)
MFNLHHKADLREIERFSCALTEANAKIEAISRSMAMIEFTPDGIVLDANENFCKTMGYSA
EEVRGKHHRIFCEESFYRSEDYAKLWRDLARGEPLSGTFLRLNKSGREIWLEASYMPVFG
PDKQVRSVIKVAADITARINKEHEEEAMLAAIGRSMAVIEFTPEGHVIRANDNFLQTMQY
AHPEIVGQHHSLFCHRAEAESAQYKAFWASLNRGEYHSHRFERKNKSGQMVYLEASYNPL
FDAKGRLYKVVKFASDITRQMTTLQNAAESAHSTSVQNDACAQKGSQVVQQTVQIIQDIS
RDLNEAAVSIDAVSKQSDIIGTIVQTIRGIADQTNLLALNAAIEAARAGEHGRGFAVVAD
EVRSLAARTSQATLEIVDVVRKNHDLSLSAVSSMQSSLSRTGLGVELANEAGEVILEIQQ
GSRHVVDAISQFNETLQLN