Protein Info for PS417_26965 in Pseudomonas simiae WCS417

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR03284: thymidylate synthase" amino acids 2 to 86 (85 residues), 113.3 bits, see alignment E=6.3e-37 amino acids 85 to 277 (193 residues), 224.1 bits, see alignment E=1.1e-70 PF00303: Thymidylat_synt" amino acids 2 to 277 (276 residues), 353.3 bits, see alignment E=3.7e-110

Best Hits

Swiss-Prot: 100% identical to TYSY_PSEFS: Thymidylate synthase (thyA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to pfs:PFLU5815)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UTH7 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PS417_26965 thymidylate synthase (Pseudomonas simiae WCS417)
MKQYLELLNDVVTNGLTKGDRTGTGTKAVFARQYRHNLADGFPLLTTKKLHFKSIANELI
WMLSGNTNIKWLNENGVRIWDEWATEDGDLGPVYGEQWTAWPTKDGGTINQIDYMVHTLK
TNPNSRRILFHGWNVEYLPDETKSPQENARNGKQALPPCHLLYQAFVHDGHLSMQLYIRS
SDVFLGLPYNTAALALLTHMLAQQCDLIPHEIIVTTGDTHAYSNHMEQIRTQLARTPKKL
PELVIKRKPASIYDYKFEDFEIVGYDADPSIKADVAI