Protein Info for GFF5262 in Variovorax sp. SCN45

Annotation: Ferric iron ABC transporter, iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13531: SBP_bac_11" amino acids 33 to 278 (246 residues), 59.4 bits, see alignment E=9.1e-20 PF13416: SBP_bac_8" amino acids 42 to 299 (258 residues), 79.3 bits, see alignment E=8.8e-26 PF01547: SBP_bac_1" amino acids 44 to 277 (234 residues), 71.5 bits, see alignment E=2.5e-23 PF13343: SBP_bac_6" amino acids 84 to 314 (231 residues), 108.7 bits, see alignment E=6.8e-35

Best Hits

Swiss-Prot: 45% identical to Y131_HAEIN: Uncharacterized protein HI_0131 (HI_0131) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 97% identity to vpe:Varpa_1181)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF5262 Ferric iron ABC transporter, iron-binding protein (Variovorax sp. SCN45)
MKNKLFTAAALLGLSAAASAQTVNVICSVQAEWCNVISTVYARTTGVRINMALKGSGEAL
AQLIAEKDNPKTDVWFGGTGDPHLQAAEQGLTLEYKSPTLSQLHPWAQQQAKQSGYKTVG
IYSGPLGFGYNPELLAKKKLPVPKTWADLLKPEYKGDIQVANPASSGTAYTMIATLVQMM
GEDKAFDYLKALHKNVGQYTRSGTGPIKAVARGETAVSISFVHDGPGEKMQGFPVETITP
SDGTGAEIGSMSIIKGARNLDAAKKFYEWALTPGAQELGAANKQFQLPSNVNAKLDPRIP
DFKKIKFINYDYAKYGASAERRRLIARWEKDVNSLPR