Protein Info for PS417_26940 in Pseudomonas simiae WCS417

Annotation: phosphonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 390 to 415 (26 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 489 to 508 (20 residues), see Phobius details amino acids 529 to 551 (23 residues), see Phobius details TIGR03262: putative 2-aminoethylphosphonate ABC transporter, permease protein" amino acids 29 to 565 (537 residues), 747.6 bits, see alignment E=4.2e-229 PF00528: BPD_transp_1" amino acids 109 to 279 (171 residues), 46.1 bits, see alignment E=2.4e-16 amino acids 388 to 554 (167 residues), 33.7 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 96% identity to pfs:PFLU5810)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGS7 at UniProt or InterPro

Protein Sequence (570 amino acids)

>PS417_26940 phosphonate ABC transporter permease (Pseudomonas simiae WCS417)
MASEMTLPMPREVSRAERGDRIFVVGGKLVWLLLLGIAVLLPLLAIFWRGFSSEAGQGGG
LVAARELLTSDNFHWLLGNSLKVSLSVAAIVVPLAYLFAYALQRTLIPGKAIWRGMSLLP
LMAPSMLPGIALVYLFGNQGMLRGLLSDNIYGFWGIVLGEVIYTFPHALMILLSALSLAD
ARLFDAASSMGASPARAFRSITWPATRQAVFAAFCLVFTLTITDFGVPVVVGGDYQVLAL
EAYKAVVGQQQFGRGALIGMVLLLPALFSFAVDAWLRRRHGDAMSGRAQVFQPAPSRLRD
ACYLAIVLLICAVLLLVFGMAVYSSLVKFWPYNLSLSLNHYQFEDTAGGGWLAYRNSLTM
ALCTALIGSVLIFTGAYLMEKTKGQKGLNLALRMLSFVPMAVPGLVLGLGYVFFFNLNGN
PLHVFYGTMTLLVVCTIAHYLTTAQMTATTVLRQLDAEFEAAALSLKAPLYRHYLKVTVP
ICLPALLDIVRYLFVSAMTTVSAAIFLYSPDTLLAAVAVLNMDDAGNVGGAAAMSTLILF
TSASVSLLLAWASRGALRRSQAWRQSAPGQ