Protein Info for GFF5261 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF00989: PAS" amino acids 14 to 121 (108 residues), 33.5 bits, see alignment E=1.1e-11 PF13188: PAS_8" amino acids 15 to 64 (50 residues), 30.2 bits, see alignment E=9.8e-11 TIGR00229: PAS domain S-box protein" amino acids 16 to 124 (109 residues), 42.6 bits, see alignment E=3e-15 PF08448: PAS_4" amino acids 21 to 125 (105 residues), 25.3 bits, see alignment E=4.6e-09 PF13426: PAS_9" amino acids 22 to 123 (102 residues), 41.6 bits, see alignment E=3.8e-14 PF00196: GerE" amino acids 130 to 183 (54 residues), 62.9 bits, see alignment E=5.1e-21 PF07638: Sigma70_ECF" amino acids 134 to 171 (38 residues), 21.6 bits, see alignment 5.3e-08

Best Hits

KEGG orthology group: None (inferred from 54% identity to mpt:Mpe_A2686)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>GFF5261 Transcriptional regulator, LuxR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTPKTLSESIAEPEMIFELAPVGLMVTRQRIIERCNRAMSEMFGYPVSALVGQSTEMLYP
SHEEFEHIGETWVASMRQNGNHRDQRIMRHANGRMFWCAVSGRSFTPESPFASVIWVFDD
ISEARPVNAPLTAREREIAARVITGLTSKQIAKDLNVSHRTVEAHRLRLMRKLDVNSTGE
LIARILGMPPSP