Protein Info for PS417_02680 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 5 to 189 (185 residues), 160.2 bits, see alignment E=6.5e-51 PF08659: KR" amino acids 5 to 163 (159 residues), 52.2 bits, see alignment E=1.1e-17 PF13561: adh_short_C2" amino acids 9 to 224 (216 residues), 111 bits, see alignment E=1.1e-35

Best Hits

Swiss-Prot: 60% identical to ISFD2_CHRSD: Sulfoacetaldehyde reductase 2 (isfD2) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU0557)

MetaCyc: 60% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVR4 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PS417_02680 hypothetical protein (Pseudomonas simiae WCS417)
MSDTLFITGATSGFGEACARRFAEAGWKLVLTGRRAERLNALVEELSKQTEVHGLVVDVR
DRKGMEDAIANLPPSFATLRGLINNAGLAVGTDPAPKCNLDDWETMVDTNIKGLLTTTNL
LLPRLIAHGRGAGIINLGSIAGNYPYPGSHVYGGSKAFVKQFSLNLRCDLQGTGVRVTNI
EPGLCESEFSLVRFGGDQARYDATYAGAEPIQPQDIADTIFWVMNTPAHVNINRLELMPV
SQTWAGFAIERGAKA