Protein Info for GFF526 in Variovorax sp. SCN45

Annotation: Tricarboxylate transport transcriptional regulator TctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 93.7 bits, see alignment E=8.2e-31 PF00486: Trans_reg_C" amino acids 152 to 222 (71 residues), 59.3 bits, see alignment E=3.2e-20

Best Hits

KEGG orthology group: K07774, two-component system, OmpR family, response regulator TctD (inferred from 93% identity to vpe:Varpa_3456)

Predicted SEED Role

"Tricarboxylate transport transcriptional regulator TctD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF526 Tricarboxylate transport transcriptional regulator TctD (Variovorax sp. SCN45)
MKLLLVEDDPSMQITLQRTLGRQRIDVRVCGDGAEAVTMWRALEPDVVALDLSLPNLDGL
QVLAQARAEGLRTPVLLLTARGTVGDRIMGLNAGADDYLPKPFDLDELEARIRALRRRSH
GVMTDMGLNPQQIGGLRFEPANGAIYNRAELLELTPRELALLKALMMKPGHAVTKERLFE
LVFPGETEVQYEAIEVVVYRLRKKLVGTGAVLMTMRGLGYLLRPEA