Protein Info for GFF5258 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 182 to 208 (27 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 248 (170 residues), 86.9 bits, see alignment E=7.3e-29

Best Hits

KEGG orthology group: None (inferred from 56% identity to bbt:BBta_5985)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF5258 Alkanesulfonates transport system permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKQRHGVLMWFASLGVLAALVGLWQLAAHLELVSPVFFPAPLRSFESLWDQMGTADFWLA
FRETLTRMVLGFVTASVAGIALGAAIGLSPRLRAYVEPTLELIRPLPASAMIPVFVLLIG
LNDRMIVTAIAFSSLWPVLLNTVHGFKTIEPRLLEVARILHLSRLEMVWKIALPNALPDI
FAGLRLALTVSLILAVVAEMLAGTIGLGQNITLAARSFRSADLYAGIIVLGAVGYVSNIL
LQRAEQHLLRWRTP