Protein Info for GFF5257 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 59 to 82 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 71 to 238 (168 residues), 65.8 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: None (inferred from 52% identity to bbt:BBta_5984)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF5257 Alkanesulfonates transport system permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MARVFKGVLFPAAVLIFWEFAARSGLLKAESLSSPFAIFRAAVGVVADGSLFKAALETFG
GAVGGLVVGATAGILVGVAFGLSRHLSQLMRVSTEALRPIPSVALIPLALLIHGYGFQME
SSIVAFSCFWPLLIITESAVRGIEPRLLEVARMLNFGLRERVTKIVLPAALPRIFVGLRL
AAAVSLVVAVTVEITANPMGLGYALIVAQESMRPDRVFAFIGWIGLIGWALNASLLRAQQ
RWFGRMGNWAEQSS