Protein Info for GFF5255 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 94 to 122 (29 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 217 to 243 (27 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details PF12911: OppC_N" amino acids 13 to 50 (38 residues), 24.7 bits, see alignment 1.8e-09 PF00528: BPD_transp_1" amino acids 110 to 303 (194 residues), 108.1 bits, see alignment E=4.8e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 95% identity to vap:Vapar_1092)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF5255 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MKKTLARWLDSDVGYSFRTSPVAIAAALIALVCVVCAVFAGWVSPHNPFDLAALELGDAR
LPPAWSAEGSSKYLLGTDDQGRDILSAVIYGARISLIVGLVSVVLSVVVGVVLGLLAGFF
GGWLDSFLMRVCDVMLSFPPILVALLIAGVGRALFPGAHESLAFGVLIVSISLTGWVQYA
RTVRGSTLVERNKEYVQAARVTGVAPMRIMLRHVLPNVLGPVTVLATIQVATAIITEATL
SFLGVGVPPTSPSLGTLISIGNQYLFSGEWWITVFPGLMLVLIALSVNLLGDWLRDALNP
RLR