Protein Info for GFF5255 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13379: NMT1_2" amino acids 32 to 254 (223 residues), 60.7 bits, see alignment E=3.2e-20 PF09084: NMT1" amino acids 41 to 255 (215 residues), 93.7 bits, see alignment E=2.3e-30 PF12974: Phosphonate-bd" amino acids 53 to 200 (148 residues), 34.3 bits, see alignment E=2.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF5255 ABC transporter substrate-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHTLIATLRSLVRPLAVATLLSAAAAPVWAQKIVFGFSASTAFANAFVAANEGIFKKHGL
DVEMKLVPNSATTPAALMAGSLQIATPTAPNTMQAVEQGLDLVVLAGGGYYTKGMEDVAI
MVRPDSPIKTAKDFEGKRVSTPGLNAFLHVLFRKWMAENGGDYKKVTFTENAFAQSVDVL
RNGQVDGILAVQPFLSRAEETGAGRVVAYYIAALEGEVQSGWHVANRKWADANPKQVEAF
RAAIQEASALAQKDPGVVRKANLVYIPFPAEVQAKFPDPKFRPVITPEVVQNWNKIMMDQ
DMLKKPIDPAKLIYK