Protein Info for GFF5246 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: PROBABLE HYDROLASE PROTEIN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF12146: Hydrolase_4" amino acids 22 to 131 (110 residues), 58.6 bits, see alignment E=1.2e-19 PF00561: Abhydrolase_1" amino acids 24 to 234 (211 residues), 89.2 bits, see alignment E=6.9e-29 PF12697: Abhydrolase_6" amino acids 26 to 262 (237 residues), 74.4 bits, see alignment E=4.3e-24 PF00975: Thioesterase" amino acids 44 to 129 (86 residues), 30.1 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 81% identity to pna:Pnap_2759)

Predicted SEED Role

"PROBABLE HYDROLASE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF5246 PROBABLE HYDROLASE PROTEIN (Hydrogenophaga sp. GW460-11-11-14-LB1)
MYLQVNGASTYCYTGGKPFDAAKPTVVFLHGVINDHSVWILQSRYLAHHGWNVLAVDLPG
HCKSEGEAPASVEDAAGFVAALLDAAGVQKAALVGHSWGSLIALESAARLQARVSHLVLV
GTAYPMKVSPALIEASLNEPEKALTMVNVFSRSTLAAPPSALGPGTWVYGSSMALGRRVL
RSNAQVNVFHRGFVACDRYAGGEAAIAQITCPVLFVLGGLDQMTNPKAAQMLVQAARTAG
KAVSIATLPVGHHQMTETPDATLFAIRDFLNR