Protein Info for GFF5244 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00571: CBS
  • amino acids 14 to 60 (47 residues), 34.4 bits, E=1.1e-12
  • amino acids 71 to 125 (55 residues), 38.1 bits, E=8e-14

Best Hits

KEGG orthology group: None (inferred from 72% identity to pol:Bpro_1837)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• ureide biosynthesis (5/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (155 amino acids)

>GFF5244 Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKVSDILRVKGGTLYTVQPQETLERAIETMSQFDIGSLAVIEHGDLVGMLTFREVIHTLA
KNGGSLGGRTVRTVMDDHPMTCTPQTELEQVRPMMLERHTRYMPVMDNKMLMGVISFYDV
AKAVVDSQNFENKMLKAYIRDWPEEESSKNEPNFP