Protein Info for GFF5243 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative calcium/proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 379 to 396 (18 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 59 to 208 (150 residues), 59.4 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K07300, Ca2+:H+ antiporter (inferred from 67% identity to put:PT7_2242)

Predicted SEED Role

"putative calcium/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>GFF5243 putative calcium/proton antiporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKVGAMANFFSRRVQRHLPRQIPLATWALLLVAWAVVGLFARYGASWLAAPLTPGVAGLA
FAVLLATIVAASFGVVHEADVLAHRLGEPYGTLILTLSIVSVEVILIASVLLGPGEAPTI
GRDSIFAVLMIILNLVMGLCLVAGAARHGEQEFNAQGATAYLSMIAVLTTVALVLPKFTG
SAGEYSSGQAIGIGALTAVLYGVFLCKQIGSHKRLFVQPPPGAMVVRRMERVSREPARAD
GPGAAGGPAIWVHALLLLAMIVPIVLLGHHLAVVLDYGIAAAGAPVAVGGVLIALIVFTP
ESLTAVRAAMANEMQRAINLCLGAFVSTVGLTVPAVLAIGLLNGKQVIMGVSHLDTALFV
ATVVLCMLTFNGQRTSSLQGYMHLVLFAVFGLLLFFP