Protein Info for GFF5242 in Variovorax sp. SCN45

Annotation: General secretion pathway protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF07963: N_methyl" amino acids 14 to 37 (24 residues), 33 bits, see alignment 3e-12 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 17 to 38 (22 residues), 28.3 bits, see alignment 1.1e-10 TIGR01707: type II secretion system protein I" amino acids 18 to 115 (98 residues), 53.1 bits, see alignment E=3.8e-18 PF02501: T2SSI" amino acids 54 to 128 (75 residues), 74.6 bits, see alignment E=5.4e-25

Best Hits

Swiss-Prot: 36% identical to GSPI_KLEPN: Type II secretion system protein I (pulI) from Klebsiella pneumoniae

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 89% identity to vpe:Varpa_1162)

Predicted SEED Role

"General secretion pathway protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>GFF5242 General secretion pathway protein I (Variovorax sp. SCN45)
MSRRLFHRRTSRNARSRGFTLIEVLIALGIVALALAAGSQATMSLTRNAQRQSDLVLADL
CAENELAKARLARQMPAVGDSGSICAQAGLSFNVTTTTVPTLNPNFRRVDVQVRDEGNAP
ILRISTVVGRY