Protein Info for GFF5240 in Variovorax sp. SCN45

Annotation: General secretion pathway protein K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF21687: T2SSK_1st" amino acids 123 to 211 (89 residues), 32.6 bits, see alignment E=1.2e-11 PF03934: T2SSK" amino acids 216 to 271 (56 residues), 39.7 bits, see alignment E=5.2e-14

Best Hits

KEGG orthology group: K02460, general secretion pathway protein K (inferred from 84% identity to vpe:Varpa_1160)

Predicted SEED Role

"General secretion pathway protein K"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF5240 General secretion pathway protein K (Variovorax sp. SCN45)
MTTTPQRNQSGAALLAAMLTVMLVATFAAAALWQQWRASEVEGAERSRVQAAWVLIGALD
WSRLILSEDGRAGGPDHLGEPWAVPLEEARLTSFLSAEKNVASDNLEGLPDAFLSGRIVD
AQSKLNVLSLVDGGKPVPASVATFTRLFNLLGLPLSELNRMTAGLVGALSSDGDADGSGA
PLMPQEVSQLVWLGLSPSTAATLEPYVTILPVRTTLNINTASAEAISASMESLSIANARQ
LVERRTRAFFKDLAAANAALPSGGTPFNAAQHGVGTQFFEVYGKLRLDRTWVEEHSLLQR
NGVTVTTVWRTRGAGATNSPVKP