Protein Info for GFF5235 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 80 to 96 (17 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 144 (133 residues), 46.9 bits, see alignment E=1.6e-16 amino acids 154 to 278 (125 residues), 48.7 bits, see alignment E=4.4e-17

Best Hits

KEGG orthology group: None (inferred from 54% identity to pol:Bpro_1004)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF5235 Membrane protein, putative (Hydrogenophaga sp. GW460-11-11-14-LB1)
VTQPESARRTALGIALLVCATLCFALLDTTSQYVGPAVPVVMAVWLRYLTQTLMTTALLW
PQRGRSLLHTRAPGWQFGRGVLMLGSSVVAYLALRHVPVGEFTAIMMLVPLAVTLLAALM
LREPVPPLTWALVIGGLAGAMIVIRPKGSDFHGAMLLPLLLVLVNAAYQILTSRMVRTED
PGTMHFYTGLLGLACCSLLLPWSWAPLADWTLWALAGLLGVFGSVGHYLLIQAYHHAPAS
RLTPYLYAQIAFATLAGWVVFGYAPDAWTVAGIGLIALCGWLGVRLRRG