Protein Info for PS417_26800 in Pseudomonas simiae WCS417

Annotation: cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 64 to 86 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 307 to 307 (1 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details PF18075: FtsX_ECD" amino acids 101 to 192 (92 residues), 63.1 bits, see alignment E=3.1e-21 PF02687: FtsX" amino acids 218 to 333 (116 residues), 36.5 bits, see alignment E=4.6e-13

Best Hits

Swiss-Prot: 84% identical to FTSX_PSEPU: Cell division protein FtsX (ftsX) from Pseudomonas putida

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 98% identity to pfs:PFLU5778)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U866 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PS417_26800 cell division protein FtsX (Pseudomonas simiae WCS417)
MSATRSPKVSERVAPKPADPQPPKKKHDHDDDGPDFSTLLRAWIESHRASLVDSLRRLGK
QPIGSFFTCLVMAVALSLPMGLSLLLNNVERLGGSWQRAAQISLYLNIDASAKDGEALRD
DIKNIPGVADAEYISRDQALEEFQQQSGLGEALKELPQNPLPGVVLVTPNEVDKPALEAL
RQKLAEMPKVQQAQLDLVWVERLAAILKLGDRFVFGLTVLLVSALLLVIGNTIRLHIENR
RTEIEVIKLVGGTDSYVRRPFLYMGALYGFGAGILSWCVLAFGLDWLNDAVVGLAGLYGS
DFALAGVPVADGLSLLLGAVLLGYIGAWIAVARHLRELAPK