Protein Info for PS417_26780 in Pseudomonas simiae WCS417

Annotation: thiamine biosynthesis protein ThiS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 TIGR01683: thiamine biosynthesis protein ThiS" amino acids 3 to 66 (64 residues), 79.4 bits, see alignment E=9.9e-27 PF02597: ThiS" amino acids 3 to 66 (64 residues), 62.9 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 34% identical to THIS_BACSU: Sulfur carrier protein ThiS (thiS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03154, sulfur carrier protein (inferred from 98% identity to pfs:PFLU5774)

MetaCyc: 34% identical to ThiS sulfur carrier protein (Bacillus subtilis subtilis 168)

Predicted SEED Role

"Sulfur carrier protein ThiS" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQ49 at UniProt or InterPro

Protein Sequence (66 amino acids)

>PS417_26780 thiamine biosynthesis protein ThiS (Pseudomonas simiae WCS417)
MRIQLNGESFELPDGETVAALLTRLDLTGRRVAVELNLDIVPRSLHADTALTEGDQVEVV
HAIGGG