Protein Info for GFF523 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: NAD(FAD)-utilizing dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12831: FAD_oxidored" amino acids 5 to 149 (145 residues), 31.5 bits, see alignment E=5.5e-11 PF07992: Pyr_redox_2" amino acids 5 to 162 (158 residues), 39.4 bits, see alignment E=2.3e-13 PF03486: HI0933_like" amino acids 5 to 392 (388 residues), 321.1 bits, see alignment E=2.1e-99 PF00890: FAD_binding_2" amino acids 5 to 48 (44 residues), 32 bits, see alignment 3.7e-11 TIGR00275: flavoprotein, HI0933 family" amino acids 7 to 392 (386 residues), 424.8 bits, see alignment E=1.5e-131 PF13450: NAD_binding_8" amino acids 8 to 39 (32 residues), 24.3 bits, see alignment (E = 1.4e-08) PF22780: HI0933_like_1st" amino acids 188 to 339 (152 residues), 172.4 bits, see alignment E=3.2e-54

Best Hits

Swiss-Prot: 88% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 99% identity to spq:SPAB_04455)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF523 NAD(FAD)-utilizing dehydrogenases (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VERFDAVIIGAGAAGMFCAAQAGQAGSRVLLIDNGKKPGRKILMSGGGRCNFTNLYVEPA
AYLSQNPHFCKSALARYTQWDFIDLVDRYGIAWHEKTLGQLFCDDSAQRIVDMLVAECDK
GGVTMRLRSEVLSVERDESGFILALNGETVTTQKLVIASGGLSMPGLGASPFGYKIAEQF
GLRVLPTRAGLVPFTLHKPLLEQLQTLSGVSVPCVITARNGTVFRENLLFTHRGLSGPAV
LQISSYWQPGELVSINLLPDLSLEDVLNEQRNAHPNQSLKNTLAMHLPKRLVECLQQLGQ
IPDVSLRQLNVRDQQALVDTLTAWQVQPNGTEGYRTAEVTLGGVDTNELSSRTMEARRVP
GLYFIGEVMDVTGWLGGYNFQWAWSSAWACAQDLAAKR