Protein Info for GFF5227 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 135 (126 residues), 64 bits, see alignment E=8.2e-22 amino acids 149 to 281 (133 residues), 55.1 bits, see alignment E=4.8e-19

Best Hits

KEGG orthology group: None (inferred from 49% identity to pol:Bpro_1843)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF5227 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
LRPRHFLQLVGLSALWGASFLFIRVAVPEIGPLVLAGCRVALAGLTLALIMRGLKQAWPW
RYWRELLLMGGLSVAVPFLLYAWAGLRLPAGYSALLNTTAVLFGTLASSWFKEDTLTARK
LLGCVCGFIGVGLIVRLGPVQPDAATIAAALACVLAAACYGCSTPLMKRATTRMQPLAIA
AGIHAGAMVLVLPGTLWAWPQATFTPTGMAAVLVMGVVTSGLAYWAHLRIIRHVTPVAAM
SPVFMIPVFGVTWGHLFLGEALSSGIFVGGALVLLASALVTGFNPLRRNPPMP