Protein Info for GFF5226 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 5 to 265 (261 residues), 243.3 bits, E=1.3e-76
• PF08501: Shikimate_dh_N
  • amino acids 7 to 89 (83 residues), 79.6 bits, E=2.5e-26
• PF01488: Shikimate_DH
  • amino acids 115 to 192 (78 residues), 31.2 bits, E=3.3e-11
• PF18317: SDH_C
  • amino acids 239 to 264 (26 residues), 35.6 bits, see alignment (E = 9e-13)

Best Hits

Swiss-Prot: 60% identical to AROE_AZOSB: Shikimate dehydrogenase (NADP(+)) (aroE) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 62% identity to pol:Bpro_4503)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Protein Sequence (273 amino acids)

>GFF5226 Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTDRYAVLGHPIGHSKSPWIHTEFARSTGQDLGYTAIETPLDGFSETVLGFRAGGGRGLN
VSLPFKLQAFEIATEPSERARLAGAANCLKFEGERILADNFDGVGLVNDLQQNLGVPLKG
KRVLLLGAGGATRGALLPIAAEQPALLAVANRTPEKAHGLRHDFAAHVPLQTGGYETLLG
HRFDVVINATSTGLSQETLPLPDGLFAPGALAYDMVYGKGLTPFLRQAKAAGVERVADGV
GMLVEQAAEAFLWWRGVRPDTKAVVRGLTVPLV