Protein Info for PS417_26755 in Pseudomonas simiae WCS417

Annotation: nucleoside-triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF01725: Ham1p_like" amino acids 7 to 193 (187 residues), 212.8 bits, see alignment E=2e-67 TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family" amino acids 7 to 194 (188 residues), 185.9 bits, see alignment E=2.3e-59

Best Hits

Swiss-Prot: 91% identical to IXTPA_PSEPK: dITP/XTP pyrophosphatase (PP_5100) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 98% identity to pfs:PFLU5769)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMD2 at UniProt or InterPro

Protein Sequence (198 amino acids)

>PS417_26755 nucleoside-triphosphate diphosphatase (Pseudomonas simiae WCS417)
MMNLTQLVLASHNAGKLKELQAMLGDAVQLRSIGEFSQVEPEETGLSFVENAILKARNAA
RISGLPALADDSGLAVDFLGGAPGIYSARYADGKGDAANNAKLLNALKDVPDAERGAQFV
CVLALVRHADDPLPILCEGLWHGRILHAASGEQGFGYDPLFWVPERNVSSAELSPADKNQ
ISHRARAMDLLRQRLSLK