Protein Info for GFF5223 in Variovorax sp. SCN45

Annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF14789: THDPS_M" amino acids 90 to 130 (41 residues), 48.9 bits, see alignment 5.7e-17 PF14602: Hexapep_2" amino acids 183 to 200 (18 residues), 11.8 bits, see alignment (E = 1.6e-05) amino acids 213 to 244 (32 residues), 53.9 bits, see alignment 1.2e-18

Best Hits

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 80% identity to bxe:Bxe_C0823)

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.117

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF5223 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) (Variovorax sp. SCN45)
MTIQRTGHRYRDVETGKTLDVWFPRHATFNNRRCLAEKVGLIAGDTVEVRIESLDAPPLS
TEDAYLRLHLLSELAVRPNEINLDGLFGLLQNVAWTSAGPVLPSKVDELRHLVAAEYHHL
TVPSIDKFPRMSDYVVPTGVRIADADRVRLGAHLSPGTTVMHEGFVNFNAGTLGESMVEG
RVTPGVTVGKNSDIGAGASIMGTLSGGGKTKNAIGERSLLGANAGIGISLGDECIVEAGL
YVTAGTKVKLPDGSVVSARTLSGKSGLLYRRNSQSGAVEVLETNAQRWGGLNTTLHSND