Protein Info for GFF522 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Low-affinity inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 472 to 494 (23 residues), see Phobius details PF01384: PHO4" amino acids 30 to 487 (458 residues), 311.7 bits, see alignment E=3.4e-97

Best Hits

Swiss-Prot: 92% identical to PITA_ECOL6: Low-affinity inorganic phosphate transporter 1 (pitA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 99% identity to ses:SARI_04049)

MetaCyc: 92% identical to metal phosphate:H+ symporter PitA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-114; TRANS-RXN-277; TRANS-RXN-278; TRANS-RXN-279; TRANS-RXN-280; TRANS-RXN0-550

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>GFF522 Low-affinity inorganic phosphate transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFFGVLLGGLSVAYAIVHMLPTDLLLNMGSAHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNAMMTGTSVVDALNIPKVINIFGSLIISPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNASSYEITRTRDAINNVETYFEQRPDLLKAVTGVDQLIPSPEPGATE
PTEFHCHPANTINALNRAKGMLANVESYDKLSVEQRSQLRRIMLCISDTTDKVVKLPGVS
SDDQRLLKKLKTDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTYA
QGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFTL
PAAIILSGVLYWLSLKII