Protein Info for GFF5219 in Variovorax sp. SCN45

Annotation: 2-aminoethylphosphonate ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 308 to 335 (28 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 396 to 421 (26 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details amino acids 487 to 513 (27 residues), see Phobius details amino acids 534 to 561 (28 residues), see Phobius details TIGR03262: putative 2-aminoethylphosphonate ABC transporter, permease protein" amino acids 27 to 570 (544 residues), 773.7 bits, see alignment E=5.3e-237 PF00528: BPD_transp_1" amino acids 114 to 277 (164 residues), 55.1 bits, see alignment E=4.3e-19 amino acids 388 to 552 (165 residues), 49.2 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 93% identity to vpe:Varpa_1139)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>GFF5219 2-aminoethylphosphonate ABC transporter permease protein (Variovorax sp. SCN45)
MSSLPSAVAVPPVAMARSSAFDRERWITGAAVLLVVLLLVVIVALPVGALVGQSFFDRAG
AFVGLANFARYLDNPALVQSAFNSLGLAALSAVICTAIAYVYAYGLTLSCMPAKGVLRAV
ALVPLLAPSLLPAISLVYLFGNQGLFKGLMGDVSIYGPLGIVLGSVFWTLPHALLILTTA
MATSDGRLYEAAQTLGASRWRIFRTVTLPSSRYGLIVAAMVVFVLVITDFGVPKVVGGQT
GVLATDIYKQVVGQQNFQMGAVVGLVLLIPAVLSFLVERRVRSKQAAALSARATPYQPEP
VKSRDRALLVFCALTAGAILVMIGMAVFASLASYWPYNLAPSFKNYDFSNMDGGGWGSYF
NSLRLAVCAAVAGAFLTFVSAYLVEKPRHFGLLRELLNLLANLPLAVPGLVLGVGYIFFF
ISPSNPLRAIYGSMTILVVCTVAHFFSVAHLTSLTALRQLDREYELVSESMGVPFWRTLW
RVHLPVALPTVLNVGGYFFVNAMTTVSAVVFLYSPQTSLAAVAVLNMDDAGDVAPAAAMA
SLIMLTAAIGRGVFALAGHWTLKRTQNWRHR