Protein Info for GFF5217 in Variovorax sp. SCN45

Annotation: Ferric iron ABC transporter, iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 13 to 340 (328 residues), 526.9 bits, see alignment E=9.7e-163 PF13531: SBP_bac_11" amino acids 32 to 288 (257 residues), 47.9 bits, see alignment E=3e-16 PF01547: SBP_bac_1" amino acids 37 to 282 (246 residues), 60.9 bits, see alignment E=4.3e-20 PF13416: SBP_bac_8" amino acids 44 to 287 (244 residues), 80.6 bits, see alignment E=3.6e-26 PF13343: SBP_bac_6" amino acids 79 to 320 (242 residues), 91.8 bits, see alignment E=1e-29

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 97% identity to vpe:Varpa_1136)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF5217 Ferric iron ABC transporter, iron-binding protein (Variovorax sp. SCN45)
MLHRQLRRAIVPAVLFSLAFAASAQGRTELLVYTALEADQVQAYKAAFEKENPSIELKFV
RDSTGIVTAKLLAEKANPQADVVWGLAATSLMLLDKEGMLQPYAPKGLDAIKANMRDPAN
PPKWVGMDVWSSAICFNTAEATKKNLPKPTSWADLTNPVYKGQITMPNPAASGTGYLMVS
GWIQMMGEEKAWKYMDALHQNIGIYSQSGSKPCRQAGAGEFALGMSFEYRANKTKREGAP
IDIVLPKEGLGWDMEATGIIKTSKKQEAAKALADWAVTKQANELYAKNFAVLALPGVQEK
LEFVPGDVEKLLAKNDFTWAAANRDRILTEWSKRYESKSEKKPL