Protein Info for PS417_26695 in Pseudomonas simiae WCS417

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 24 to 139 (116 residues), 57.3 bits, E=6e-20

Best Hits

Swiss-Prot: 90% identical to PYRR_PSEFL: Bifunctional protein PyrR (pyrR) from Pseudomonas fluorescens

KEGG orthology group: K02825, pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 98% identity to pfs:PFLU5757)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9) / Pyrimidine operon regulatory protein PyrR" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A0A1N7UDP8 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PS417_26695 uracil phosphoribosyltransferase (Pseudomonas simiae WCS417)
MSLPNPAELISQMATSLTAHLQHRSISEPRFIGIRTGGVWVAQALLEALGSDSPLGTLDV
SFYRDDFSQNGLHPQVRPSALPFEIEGQHLVLIDDVLMSGRTIRAAMNELFDYGRPASVT
LVCLLDLDAGELPISPDVVGATLSLQAHQRVKLSGPTPLELELQDLAL