Protein Info for PS417_26680 in Pseudomonas simiae WCS417

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details PF13103: TonB_2" amino acids 204 to 275 (72 residues), 28.9 bits, see alignment E=1e-10 PF03544: TonB_C" amino acids 215 to 292 (78 residues), 61.6 bits, see alignment E=8.1e-21 TIGR01352: TonB family C-terminal domain" amino acids 217 to 292 (76 residues), 52.8 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 99% identity to pfs:PFLU5754)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQ34 at UniProt or InterPro

Protein Sequence (301 amino acids)

>PS417_26680 energy transducer TonB (Pseudomonas simiae WCS417)
MTLPSELPPELSHSGVRPADRLGFTLFLAALIHLALILGVGFTMVEPKQISKTLEITLAT
FKSEKKPEKADFLAQDNQQGSGTLDKKAVPKTTEVAPFQDNKVNKVTPPPVPKPEVKQAA
PKAAVTTVAPKPQKAPTQREKTKTEPTPEPVKPAPTFDSSTLSDEISSLEAELANEQQLY
AKRPRIYRLNAASTMRDKGAWYKDEWRKKVERIGNLNYPEEARRQQIYGNLRLLVSINRD
GTLYEVQVLESSGQPLLDQAAQRIVRLAAPFAPFSGDLNDVDRLEIIRTWKFAKGDRLSS
N