Protein Info for GFF5202 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Bll3817 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 13 to 189 (177 residues), 234.9 bits, see alignment E=5.4e-74 PF02627: CMD" amino acids 55 to 102 (48 residues), 33.4 bits, see alignment E=1.8e-12 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 70 to 102 (33 residues), 33.7 bits, see alignment 2e-12

Best Hits

KEGG orthology group: None (inferred from 86% identity to pna:Pnap_2668)

Predicted SEED Role

"Bll3817 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF5202 Bll3817 protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAPDNLKETRMSRYPAPDINDLPEDIKAKVLEVQEKAGFVPNVFLALARRPAEWRAFFAY
HDALMLKEEGSLTKGDREMIVTTTSAANQCLYCVVAHGAILRIYEKKPLVADQVAVNYRK
ADITPRQKAMLDFAMKVCQRSHEVNDDDFAPLHAHGFSDEDIWDIAAITAFFGLSNRLAS
FSNMQPNPEFYLMGRVPKAKPPKD