Protein Info for PS417_02650 in Pseudomonas simiae WCS417

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 27 to 66 (40 residues), 25.8 bits, 1.3e-09
• PF01266: DAO
  • amino acids 29 to 380 (352 residues), 228 bits, E=5.1e-71
• PF13450: NAD_binding_8
  • amino acids 32 to 61 (30 residues), 26.7 bits, see alignment (E = 1.1e-09)

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU0550)

MetaCyc: 64% identical to pipecolate oxidase (Pseudomonas putida)
L-pipecolate oxidase. [EC: 1.5.3.7]

Predicted SEED Role

"L-pipecolate oxidase (1.5.3.7)" in subsystem Lysine degradation

MetaCyc Pathways

• L-lysine degradation V (5/9 steps found)
• L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
• superpathway of L-lysine degradation (17/43 steps found)

KEGG Metabolic Maps

• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.3.7

Sequence Analysis Tools

See A0A1N7UF62 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PS417_02650 FAD-dependent oxidoreductase (Pseudomonas simiae WCS417)
MALRETCLWEHLTPSRPDRAALKGEVKVDVCVIGAGITGLSAATHLLEQGKSVAVLEAHR
TGHGGSGRNVGLVNAGMWIPPDEIEAGFGEAVGSQLNRMLGAAPSLVFSLIDKYNIDCQL
RREGTLHMAHNARGEADLRSREEQWKRRGAPVELLTGQACEQATGTKRIAAALLDRRAGT
LNPMAYTSGLANAAVGLGGQLFDHSPVTQLERQGAHWSVQTAQGSVQAAQVVIASNAYTE
GEWTELRRNFFPGYYYQVASAPLTDDAASQILPGGQGSWDTRQVLSSIRRDADGRLLLGS
LGNGSQKPTWFLKAWADRVQQHYFPYLKSVQWEYTWTGCIAFTPDHLMRLFEPAPGLVAV
TGYNGRGVTTGSVVGKAFADYLCHQNPQALPIPFAPMQPLAGVGLRSCLYEAGFSLYHAG
QCLRIVI