Protein Info for GFF52 in Methylophilus sp. DMC18

Annotation: Hydrazine synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF10282: Lactonase" amino acids 22 to 130 (109 residues), 32.2 bits, see alignment E=2.8e-11 amino acids 184 to 303 (120 residues), 41.4 bits, see alignment E=4.4e-14 PF02239: Cytochrom_D1" amino acids 26 to 143 (118 residues), 30 bits, see alignment E=8.2e-11 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 66 to 104 (39 residues), 31.5 bits, see alignment 6.9e-12 amino acids 236 to 275 (40 residues), 54.2 bits, see alignment 5.4e-19 amino acids 277 to 317 (41 residues), 58.5 bits, see alignment 2.5e-20 PF21783: YNCE" amino acids 211 to 315 (105 residues), 30.4 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 52% identity to mfa:Mfla_2304)

Predicted SEED Role

"surface antigen gene"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>GFF52 Hydrazine synthase subunit beta (Methylophilus sp. DMC18)
MQYARLLTLTAGLLASLTLSAQPLAYVPNEKDGTVSVIDTSTDEVINTLPNKGKLGKKVQ
AAAIHPSNQKLYVVVRDKNAVSVVDTKLGKQTALIKVGDEPEGIDISPDGKLLAACLEEE
NAVSLVDLQTNKLKHTIKTQGKNPEHCVFSPDQQWLLASNEESNNVDVINLNTLKSEHLI
ASTKHPRGVGFSPDGKWAYVANEAASLLEIVSTADWKVQANIKVGLRSNGVKVNADGSRI
YVSNGGDHNLSVIDTATREVIATIPVGQRPWNMALTPDGKKLYVANGRSNNVSVIDTQTN
AKLKDIAVGNLPWGVVIH