Protein Info for PS417_26595 in Pseudomonas simiae WCS417

Annotation: phosphoribosyl-dephospho-CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details PF20866: MdcG_N" amino acids 4 to 71 (68 residues), 43.6 bits, see alignment E=2.5e-15 TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase" amino acids 4 to 187 (184 residues), 157.2 bits, see alignment E=2.5e-50 PF10620: MdcG" amino acids 74 to 189 (116 residues), 118.5 bits, see alignment E=1.6e-38

Best Hits

Swiss-Prot: 63% identical to MDCG_PSEPF: Phosphoribosyl-dephospho-CoA transferase (mdcG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K13934, phosphoribosyl-dephospho-CoA transferase [EC: 2.7.7.66] (inferred from 80% identity to pfs:PFLU5738)

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDM9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>PS417_26595 phosphoribosyl-dephospho-CoA transferase (Pseudomonas simiae WCS417)
MVNAHDLLWGMTPAHLPADAAAWAVEAVGTVVVRRAIVAPGLVAVGVRGRLREQRFAAEL
PIAAVQRRVVPEALRDVVSTRDLPALQALEQLRPVLAPLNWGITGSAGFELATGIEAMHA
QSDLDLILRTPAPLDRNDARDLLATLDKAACTVDLQLQTPFGAVALREWAGPSRRVLLKT
AGGAHLVIDPWQAVA