Protein Info for GFF5193 in Variovorax sp. SCN45

Annotation: Galactofuranose ABC transporter, substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 38 to 294 (257 residues), 166.7 bits, see alignment E=1.1e-52 PF00532: Peripla_BP_1" amino acids 49 to 259 (211 residues), 54.1 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 54% identical to YTFQ_ECOLI: ABC transporter periplasmic-binding protein YtfQ (ytfQ) from Escherichia coli (strain K12)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 96% identity to vpe:Varpa_1113)

MetaCyc: 54% identical to galactofuranose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF5193 Galactofuranose ABC transporter, substrate-binding protein (Variovorax sp. SCN45)
MTMNRRTLNTALAAAALGSMLPVSVFAQKKLVLGFAQVGAESEWRTANTESIKSSAKDAG
IELKFSDAQQKQENQIKAIRSYIAQKVDVIAFSPVVESGWETVLREAKAAKIPVVLTDRS
VSTKDDSLYVTFMGSDFIEEGRKAGRWLVEKMKDQKGDVNIVELQGTVGSAPAIDRKKGF
EEIIKADPKFKIIRSQTGDFTRAKGKEVMEAFLKADGKKINVLFAHNDDMAIGAIQAIEE
AGLKPAKDIVIISIDGVKGAFEAMIAGKLNVSVECSPLLGPQLMQAVKDIKDGKTLPKRI
VTVESIFPMEVAAKEFPNRKY