Protein Info for PS417_26590 in Pseudomonas simiae WCS417

Annotation: malonate decarboxylase subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03131: malonate decarboxylase, epsilon subunit
  • amino acids 4 to 289 (286 residues), 325.7 bits, E=1.5e-101
• PF00698: Acyl_transf_1
  • amino acids 6 to 273 (268 residues), 89 bits, E=2.1e-29

Best Hits

KEGG orthology group: K13935, malonate decarboxylase epsilon subunit [EC: 2.3.1.39] (inferred from 91% identity to pfs:PFLU5737)

MetaCyc: 54% identical to [acyl-carrier protein] S-malonyltransferase (Klebsiella pneumoniae)
Biotin-independent malonate decarboxylase. [EC: 4.1.1.88]; 2.3.1.- [EC: 4.1.1.88]

Predicted SEED Role

"Malonyl CoA acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Malonate decarboxylase (EC 2.3.1.39)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• malonate degradation I (biotin-independent) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• fatty acid biosynthesis initiation (plant mitochondria) (1/4 steps found)
• mycobactin biosynthesis (2/11 steps found)
• pederin biosynthesis (2/14 steps found)
• bryostatin biosynthesis (2/19 steps found)
• mupirocin biosynthesis (2/26 steps found)
• corallopyronin A biosynthesis (2/30 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39, 4.1.1.88

Use Curated BLAST to search for 2.3.1.39 or 4.1.1.88

Sequence Analysis Tools

See A0A1N7U546 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PS417_26590 malonate decarboxylase subunit epsilon (Pseudomonas simiae WCS417)
MSSLLVFPGQGAQRPGMLQALPADVLEQASDALGEDVRALDSAQALANTRAVQLCLLIVG
VAHARQLQRTPDYVAGLSIGAYPAAVIAGALDFADAIRLVSLRGELMQNAYPQGYGMTAI
IGPELSTVEHLLTDIHSPDSPVYLANINADNQTVIAGSNAAMKRVADRIKGNGVAKRLAV
SVPSHCALLEQPAQVLAQAFVPLKAPRITYLSSTRARPIHNPEQLRDDLAFNMCRIVDWR
GTVQSAYERGVRLQIELPPGAVLTGLSRRVFEQGTVIACEGARLDTLQALLEEEGLRHR