Protein Info for GFF5190 in Variovorax sp. SCN45

Annotation: L-arabinose 1-dehydrogenase (EC 1.1.1.376)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 19 to 34 (16 residues), see Phobius details PF00106: adh_short" amino acids 16 to 207 (192 residues), 134.3 bits, see alignment E=3.9e-43 PF13561: adh_short_C2" amino acids 24 to 257 (234 residues), 184 bits, see alignment E=3.5e-58

Best Hits

Swiss-Prot: 45% identical to GALD_RHIME: Probable galactose dehydrogenase GalD (galD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_1041)

Predicted SEED Role

"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF5190 L-arabinose 1-dehydrogenase (EC 1.1.1.376) (Variovorax sp. SCN45)
LNSTQLSIHPSLKGRTVFVTGGGSGIGAAIVAAFAAQGARVAFVDIAEGASAQLARQIVD
AGHAAPWWRACDVRDIAALQQAIADAARELGDFAVLVNNVASDDRHTLESVTPDYYDNRM
AINERPALFAIQSVVPGMKRLGFGSVVNLGSTGWQTKGSGYPCYAIAKSSVNGLTRGLAV
ELGRERIRINTVSPGWVMTERQVKLWLDEEGEKALHRNQCLPDKLMPEDIARMVLFLASD
DAKMCTAQEFTVDAGWT