Protein Info for GFF519 in Xanthobacter sp. DMC5

Annotation: HTH-type transcriptional regulator CueR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF13411: MerR_1" amino acids 18 to 83 (66 residues), 63.5 bits, see alignment E=2.4e-21 PF00376: MerR" amino acids 19 to 54 (36 residues), 37.4 bits, see alignment E=2.7e-13 PF09278: MerR-DNA-bind" amino acids 59 to 125 (67 residues), 48.7 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 83% identity to xau:Xaut_4442)

Predicted SEED Role

"Predicted transcriptional regulator LiuR of leucine degradation pathway, MerR family" in subsystem HMG CoA Synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>GFF519 HTH-type transcriptional regulator CueR (Xanthobacter sp. DMC5)
VASSGKRGGASALTDTFFTVTQLARDLSVTPRTIRFYEDKGLITPRRAGTMRVYTKRDRA
RMALILRGKRLGFSLREIKDYLDLYDLDPSQSEQIRLLLKKVQDRLEMLEDQRLALEETI
IELKDIEEQALSALASSETGDQKAAG