Protein Info for GFF519 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 44 to 263 (220 residues), 89.5 bits, see alignment E=2.4e-29 PF12974: Phosphonate-bd" amino acids 65 to 243 (179 residues), 38 bits, see alignment E=1.9e-13 PF09084: NMT1" amino acids 128 to 195 (68 residues), 24.8 bits, see alignment E=2.8e-09

Best Hits

Swiss-Prot: 43% identical to GLTI_ECOLI: Glutamate/aspartate import solute-binding protein (gltI) from Escherichia coli (strain K12)

KEGG orthology group: K10001, glutamate/aspartate transport system substrate-binding protein (inferred from 88% identity to dac:Daci_1364)

MetaCyc: 43% identical to glutamate/aspartate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF519 Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKKHLLALAVTTLAVGSAFAQAGDTLAKIKASGSVSLGVRESSGLGYTLGNGKYVGFHTE
MGEIILADIQKQLGLAKLNVNYQPVTSQNRIPLVQNGTVDIECGSTTNNATRQKDVSFAV
TTYVEEVRIAVKANSGITGIKDLNGKTVATTTGTTSVQTLRKNERAGGIDFKEVYGKDHA
DSFLALESGRADAFVMDGSILAANISKSKNPADYKIVGEVLSVEPIACMLRKDDPAFKKA
VDDSIKRQIADGSLAKLYDKWFMQPIPPANVKIGLPLSDATKAAWASPNDKPMEDYAKK